PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DL_8AAFB7B06.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 446aa    MW: 49134.6 Da    PI: 8.1609
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DL_8AAFB7B06.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.77.2e-174498256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           r+ +++t++q+++Le +F  + +p++++r  +++++gLt +qVk+WFqN+R+ +k
  Traes_3DL_8AAFB7B06.1 44 RRLQRLTPQQTQVLEGFFGICAHPDENQRMGMSESTGLTMQQVKFWFQNKRTHMK 98
                           666899**********************************************998 PP

2START91.61.6e-291974121203
                            HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                  START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                            ela++a+ e+v + +a+ p+W+ ++    + +n++ + q+f    +      + +ea ra  +v m++ + v  ++d+  +++  ++ 
  Traes_3DL_8AAFB7B06.1 197 ELAQSAMHEFVVLSEAGGPLWMPVPggsfDVLNNMAYAQTFGARSSanvilgFMTEATRADDMVMMDAKRIVDYIMDSE-CYTSFCPg 283
                            57899************************************66555899**99****************9999888888.*****999 PP

                            ......EEEEEEEECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEE CS
                  START  78 ......kaetlevissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgilie 155
                                    ++++  +s+   ga +l + e+++ splvp R+ +fvR++r ++ g+ +ivdvS+d+ +        v++++ pSg l++
  Traes_3DL_8AAFB7B06.1 284 lvtsanTTKVYKWPTSAgynGAMHLVTVETVFASPLVPsRKCTFVRCCRDMQNGTVIIVDVSLDNGDGT------VKCHKMPSGVLVR 365
                            999555555555555658**********************************************99984......79*********** PP

                            EECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
                  START 156 pksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                            ++    s+vt++ehv +++   h+l+r+++ sgl++ga++wv+   rq
  Traes_3DL_8AAFB7B06.1 366 SLNSDASQVTVIEHVQVNDTGLHELYRPTL-SGLMFGARRWVSSIVRQ 412
                            *****************************9.6999*******876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-182794IPR009057Homeodomain-like
SuperFamilySSF466891.59E-162799IPR009057Homeodomain-like
PROSITE profilePS5007114.80340100IPR001356Homeobox domain
SMARTSM003891.0E-1342104IPR001356Homeobox domain
CDDcd000861.61E-144399No hitNo description
PfamPF000461.8E-144498IPR001356Homeobox domain
PROSITE patternPS0002707598IPR017970Homeobox, conserved site
CDDcd146860.00784146167No hitNo description
PROSITE profilePS5084820.585188418IPR002913START domain
SuperFamilySSF559611.37E-15193413No hitNo description
CDDcd088751.00E-69195414No hitNo description
SMARTSM002342.1E-6197415IPR002913START domain
PfamPF018524.4E-22197409IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MTGNHGGRRR KAPQQGRPAR DDAVDISQSN SDGQDGAEGS QPKRRLQRLT PQQTQVLEGF  60
FGICAHPDEN QRMGMSESTG LTMQQVKFWF QNKRTHMKHV TGKEETYRMK AQNEMLREEN  120
KRLASAANTS FCPSCVALPG LNPSGEVQTL RQENEQLKQQ LSQLRAEAHP SSSRPFQLDP  180
STENITGREN DMDAIAELAQ SAMHEFVVLS EAGGPLWMPV PGGSFDVLNN MAYAQTFGAR  240
SSANVILGFM TEATRADDMV MMDAKRIVDY IMDSECYTSF CPGLVTSANT TKVYKWPTSA  300
GYNGAMHLVT VETVFASPLV PSRKCTFVRC CRDMQNGTVI IVDVSLDNGD GTVKCHKMPS  360
GVLVRSLNSD ASQVTVIEHV QVNDTGLHEL YRPTLSGLMF GARRWVSSIV RQSARLRDLF  420
IVSKSASNGN TNGRKTLMKI ADGLLA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF3320360.0JF332036.1 Triticum turgidum subsp. durum HD-Zip IV transcription factor GL9H2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660716.11e-151PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY01e-142TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLW5DBK70.0W5DBK7_WHEAT; Uncharacterized protein
STRINGMLOC_13375.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.14e-70protodermal factor 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]